Recombinant Full Length Rat Neuronal Acetylcholine Receptor Subunit Beta-2(Chrnb2) Protein, His-Tagged
Cat.No. : | RFL35814RF |
Product Overview : | Recombinant Full Length Rat Neuronal acetylcholine receptor subunit beta-2(Chrnb2) Protein (P12390) (25-500aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (25-500) |
Form : | Lyophilized powder |
AA Sequence : | TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQ EWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFW LPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSDVASLDDFTPSGEWDI IALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEK MTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRS PTTHTMAPWVKVVFLEKLPTLLFLQQPRHRCARQRLRLRRRQREREGAGALFFREGPAAD PCTCFVNPASVQGLAGAFRAEPTAAGPGRSVGPCSCGLREAVDGVRFIADHMRSEDDDQS VREDWKYVAMVIDRLFLWIFVFVCVFGTVGMFLQPLFQNYTATTFLHPDHSAPSSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Chrnb2 |
Synonyms | Chrnb2; Acrb2; Neuronal acetylcholine receptor subunit beta-2; Neuronal acetylcholine receptor non-alpha-1 chain; N-alpha 1 |
UniProt ID | P12390 |
◆ Recombinant Proteins | ||
CHRNB2-11217H | Recombinant Human CHRNB2, His-tagged | +Inquiry |
CHRNB2-1286H | Recombinant Human CHRNB2 Protein, GST-Tagged | +Inquiry |
RFL35814RF | Recombinant Full Length Rat Neuronal Acetylcholine Receptor Subunit Beta-2(Chrnb2) Protein, His-Tagged | +Inquiry |
CHRNB2-0003H | Recombinant Human CHRNB2 protein, His-V5-tagged | +Inquiry |
CHRNB2-3242HF | Recombinant Full Length Human CHRNB2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNB2-7512HCL | Recombinant Human CHRNB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Chrnb2 Products
Required fields are marked with *
My Review for All Chrnb2 Products
Required fields are marked with *
0
Inquiry Basket