Recombinant Full Length Chicken Transmembrane Protein Adipocyte-Associated 1 Homolog(Tpra1) Protein, His-Tagged
Cat.No. : | RFL27431GF |
Product Overview : | Recombinant Full Length Chicken Transmembrane protein adipocyte-associated 1 homolog(TPRA1) Protein (Q5ZII3) (1-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-364) |
Form : | Lyophilized powder |
AA Sequence : | MSDNITRSTALVTALENVTTLSPTTTQAINDTNITVPHKCLLLLYEDIGKSRVRYWDLLL LVPNVLFFMFLLWKLPSARAKIRVTSSPIFTTFYILVFVVALVGIARAVVSMTVSASDAA TVADKILWEITRFFLLAIELSVVILGLAFGHLESKSSVKRVLAITAVLSLAYSVTQGTLE ILYPDAHLSAEDFNIYGHGGRHFWLASSCFFFLVYSFVVILPKTPLKDRISLPSRKSFYV YAGILAVLNLVQGLGSALLCVDIIEGLCCVDATTFLYFSFFAPLIYVAFLKGFFGSEPKI LFSYKCQVDEPEDVDVHLPHAYAVAKKEGMDSGFYSSTQIDTTAYLDDVALYALSCGQHQ QHRQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TPRA1 |
Synonyms | TPRA1; GPR175; RCJMB04_25o2; Transmembrane protein adipocyte-associated 1 homolog; Integral membrane protein GPR175 |
UniProt ID | Q5ZII3 |
◆ Recombinant Proteins | ||
TPRA1-17267M | Recombinant Mouse TPRA1 Protein | +Inquiry |
TPRA1-5497HF | Recombinant Full Length Human TPRA1 Protein | +Inquiry |
TPRA1-9546M | Recombinant Mouse TPRA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL2059RF | Recombinant Full Length Rat Transmembrane Protein Adipocyte-Associated 1(Tpra1) Protein, His-Tagged | +Inquiry |
TPRA1-5215H | Recombinant Human TPRA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPRA1-743HCL | Recombinant Human TPRA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPRA1 Products
Required fields are marked with *
My Review for All TPRA1 Products
Required fields are marked with *
0
Inquiry Basket