Recombinant Human TPRA1 Protein, GST-tagged

Cat.No. : TPRA1-5216H
Product Overview : Human GPR175 partial ORF ( NP_057456, 281 a.a. - 371 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : TPRA1 (Transmembrane Protein Adipocyte Associated 1) is a Protein Coding gene. GO annotations related to this gene include G-protein coupled receptor activity.
Molecular Mass : 35.75 kDa
AA Sequence : RGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSINSTDSERWKAI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TPRA1 transmembrane protein adipocyte associated 1 [ Homo sapiens (human) ]
Official Symbol TPRA1
Synonyms TPRA1; transmembrane protein adipocyte associated 1; GPR175; TPRA40; TMEM227; transmembrane protein adipocyte-associated 1; G protein-coupled receptor 175; integral membrane protein GPR175; seven transmembrane domain orphan receptor; transmembrane domain protein regulated in adipocytes 40 kDa; transmembrane protein 227; transmembrane protein, adipocyte asscociated 1
Gene ID 131601
mRNA Refseq NM_001136053
Protein Refseq NP_001129525
MIM 608336
UniProt ID Q86W33

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPRA1 Products

Required fields are marked with *

My Review for All TPRA1 Products

Required fields are marked with *

0
cart-icon