Recombinant Human TPRA1 Protein, GST-tagged
Cat.No. : | TPRA1-5216H |
Product Overview : | Human GPR175 partial ORF ( NP_057456, 281 a.a. - 371 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | TPRA1 (Transmembrane Protein Adipocyte Associated 1) is a Protein Coding gene. GO annotations related to this gene include G-protein coupled receptor activity. |
Molecular Mass : | 35.75 kDa |
AA Sequence : | RGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSINSTDSERWKAI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TPRA1 transmembrane protein adipocyte associated 1 [ Homo sapiens (human) ] |
Official Symbol | TPRA1 |
Synonyms | TPRA1; transmembrane protein adipocyte associated 1; GPR175; TPRA40; TMEM227; transmembrane protein adipocyte-associated 1; G protein-coupled receptor 175; integral membrane protein GPR175; seven transmembrane domain orphan receptor; transmembrane domain protein regulated in adipocytes 40 kDa; transmembrane protein 227; transmembrane protein, adipocyte asscociated 1 |
Gene ID | 131601 |
mRNA Refseq | NM_001136053 |
Protein Refseq | NP_001129525 |
MIM | 608336 |
UniProt ID | Q86W33 |
◆ Recombinant Proteins | ||
TPRA1-3333Z | Recombinant Zebrafish TPRA1 | +Inquiry |
TPRA1-4737R | Recombinant Rhesus Macaque TPRA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TPRA1-5215H | Recombinant Human TPRA1 Protein | +Inquiry |
TPRA1-17267M | Recombinant Mouse TPRA1 Protein | +Inquiry |
RFL11129DF | Recombinant Full Length Danio Rerio Transmembrane Protein Adipocyte-Associated 1 Homolog(Tpra1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPRA1-743HCL | Recombinant Human TPRA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPRA1 Products
Required fields are marked with *
My Review for All TPRA1 Products
Required fields are marked with *
0
Inquiry Basket