Recombinant Human TPRA1 Protein, GST-tagged

• Cat.No.: TPRA1-5216H
• Product Overview: Human GPR175 partial ORF ( NP_057456, 281 a.a. - 371 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: TPRA1 (Transmembrane Protein Adipocyte Associated 1) is a Protein Coding gene. GO annotations related to this gene include G-protein coupled receptor activity.
• Molecular Mass: 35.75 kDa
• AA Sequence: RGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSINSTDSERWKAI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TPRA1 transmembrane protein adipocyte associated 1 [ Homo sapiens (human) ]
• Official Symbol: TPRA1
• Synonyms: TPRA1; transmembrane protein adipocyte associated 1; GPR175; TPRA40; TMEM227; transmembrane protein adipocyte-associated 1; G protein-coupled receptor 175; integral membrane protein GPR175; seven transmembrane domain orphan receptor; transmembrane domain protein regulated in adipocytes 40 kDa; transmembrane protein 227; transmembrane protein, adipocyte asscociated 1
• Gene ID: 131601
• mRNA Refseq: NM_001136053
• Protein Refseq: NP_001129525
• MIM: 608336
• UniProt ID: Q86W33