Recombinant Human TPRA1 Protein, GST-tagged
| Cat.No. : | TPRA1-5216H |
| Product Overview : | Human GPR175 partial ORF ( NP_057456, 281 a.a. - 371 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | TPRA1 (Transmembrane Protein Adipocyte Associated 1) is a Protein Coding gene. GO annotations related to this gene include G-protein coupled receptor activity. |
| Molecular Mass : | 35.75 kDa |
| AA Sequence : | RGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSINSTDSERWKAI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TPRA1 transmembrane protein adipocyte associated 1 [ Homo sapiens (human) ] |
| Official Symbol | TPRA1 |
| Synonyms | TPRA1; transmembrane protein adipocyte associated 1; GPR175; TPRA40; TMEM227; transmembrane protein adipocyte-associated 1; G protein-coupled receptor 175; integral membrane protein GPR175; seven transmembrane domain orphan receptor; transmembrane domain protein regulated in adipocytes 40 kDa; transmembrane protein 227; transmembrane protein, adipocyte asscociated 1 |
| Gene ID | 131601 |
| mRNA Refseq | NM_001136053 |
| Protein Refseq | NP_001129525 |
| MIM | 608336 |
| UniProt ID | Q86W33 |
| ◆ Cell & Tissue Lysates | ||
| TPRA1-743HCL | Recombinant Human TPRA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPRA1 Products
Required fields are marked with *
My Review for All TPRA1 Products
Required fields are marked with *
