Recombinant Human TMEM230 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TMEM230-481H |
Product Overview : | C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_001009924) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a multi-pass transmembrane protein that belongs to the TMEM134/TMEM230 protein family. The encoded protein localizes to secretory and recycling vesicle in the neuron and may be involved in synaptic vesicles trafficking and recycling. Mutations in this gene may be linked to familial Parkinson's disease. |
Molecular Mass : | 13.2 kDa |
AA Sequence : | MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TMEM230 transmembrane protein 230 [ Homo sapiens (human) ] |
Official Symbol | TMEM230 |
Synonyms | TMEM230; transmembrane protein 230; HSPC274; C20orf30; dJ1116H23.2.1; transmembrane protein 230; UPF0414 transmembrane protein C20orf30 |
Gene ID | 29058 |
mRNA Refseq | NM_001009924 |
Protein Refseq | NP_001009924 |
MIM | 617019 |
UniProt ID | Q96A57 |
◆ Recombinant Proteins | ||
Tmem230-6493M | Recombinant Mouse Tmem230 Protein, Myc/DDK-tagged | +Inquiry |
TMEM230-1786C | Recombinant Chicken TMEM230 | +Inquiry |
TMEM230-1647H | Recombinant Human TMEM230 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL28363HF | Recombinant Full Length Human Upf0414 Transmembrane Protein C20Orf30(C20Orf30) Protein, His-Tagged | +Inquiry |
TMEM230-178H | Recombinant Human TMEM230 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM230-8115HCL | Recombinant Human C20orf30 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM230 Products
Required fields are marked with *
My Review for All TMEM230 Products
Required fields are marked with *