Recombinant Full Length Cricetulus Griseus Lysosome-Associated Membrane Glycoprotein 2(Lamp2) Protein, His-Tagged
Cat.No. : | RFL34345CF |
Product Overview : | Recombinant Full Length Cricetulus griseus Lysosome-associated membrane glycoprotein 2(LAMP2) Protein (P49130) (29-410aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cricetulus griseus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (29-410) |
Form : | Lyophilized powder |
AA Sequence : | FELNLPDSKATCLFAKWKMNFTISYETTTNKTLKTVTISEPHNVTYNGSSCGDDQGVAKIAVQFGSTVSWNVTFTKEESHYVIGSIWLVYNTSDNTTFPGAIPKGSATVISSQSIEIPLDDIFRCNSLLTFKTGNVVQNYWDIHLQAFVQNGTVSKEEFVCEEDKSVTTVRPIIHTTVPPPTTTPTPLPPKVGNYSVSNGNATCLLATMGLQLNVTEEKVPFIFNINPSTTNFTGSCHPQTAQLRLNNSQIKYLDFIFAVKSESHFYLKEVNVSMYMANGSVFSVANNNLSFWDAPLGSSYMCNKEQVVSVSRTFQINTFNLKVQPFNVTKGKYATAQDCSADEDNFLVPIAVGAALAGVLALVLLAYFIGLKRHHTGYEQF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LAMP2 |
Synonyms | LAMP2; LGPB; Lysosome-associated membrane glycoprotein 2; LAMP-2; Lysosome-associated membrane protein 2; CD107 antigen-like family member B; Lysosomal membrane glycoprotein B; LGP-B; CD antigen CD107b |
UniProt ID | P49130 |
◆ Recombinant Proteins | ||
LAMP2-2200Z | Recombinant Zebrafish LAMP2 | +Inquiry |
LAMP2-163H | Recombinant Human LAMP2 Protein, MYC/DDK-tagged | +Inquiry |
Lamp2-6974M | Recombinant Mouse Lamp2 protein(Leu26-Asn379), His-tagged | +Inquiry |
RFL27349MF | Recombinant Full Length Mouse Lysosome-Associated Membrane Glycoprotein 2(Lamp2) Protein, His-Tagged | +Inquiry |
LAMP2-1145C | Recombinant Chicken LAMP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAMP2-987CCL | Recombinant Cynomolgus LAMP2 cell lysate | +Inquiry |
LAMP2-1756MCL | Recombinant Mouse LAMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAMP2 Products
Required fields are marked with *
My Review for All LAMP2 Products
Required fields are marked with *
0
Inquiry Basket