Recombinant Full Length Danio Rerio Leucine-Rich Repeat-Containing Protein 3B(Lrrc3B) Protein, His-Tagged
| Cat.No. : | RFL9537DF |
| Product Overview : | Recombinant Full Length Danio rerio Leucine-rich repeat-containing protein 3B(lrrc3b) Protein (A3KNN3) (34-258aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | zebrafish |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (34-258) |
| Form : | Lyophilized powder |
| AA Sequence : | CPKGCTCQRSESPPHGLNVTCSLSRLKEIPPDVPPDTQLLQLDRNHISLVPDRIFHGLRM LRRLNLSHNAVETLGEGAFIGLEGSLEVLDLSYNRITSVHKDAFARLKARVVVDNNPWHC DCALQQALGGMAHNHERVLCRSSELRDQEGQPFMAVDADLCNLAKRTTDYAMLVTMFGWF AMVISYVVYYVRQNQEDARRHLEYLKSLPSKPKKPDEPEDISTVV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | lrrc3b |
| Synonyms | lrrc3b; zgc:162270; Leucine-rich repeat-containing protein 3B |
| UniProt ID | A3KNN3 |
| ◆ Recombinant Proteins | ||
| LRRC3B-3995H | Recombinant Human LRRC3B Protein (Cys34-Tyr204), C-His tagged | +Inquiry |
| LRRC3B-4303H | Recombinant Human LRRC3B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Lrrc3b-3830M | Recombinant Mouse Lrrc3b Protein, Myc/DDK-tagged | +Inquiry |
| RFL9537DF | Recombinant Full Length Danio Rerio Leucine-Rich Repeat-Containing Protein 3B(Lrrc3B) Protein, His-Tagged | +Inquiry |
| LRRC3B-636H | Recombinant Human LRRC3B, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LRRC3B-4631HCL | Recombinant Human LRRC3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All lrrc3b Products
Required fields are marked with *
My Review for All lrrc3b Products
Required fields are marked with *



