Recombinant Full Length Dictyostelium Discoideum Fk506-Binding Protein 3(Fkbp3) Protein, His-Tagged
Cat.No. : | RFL26959DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum FK506-binding protein 3(fkbp3) Protein (Q54N80) (20-194aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-194) |
Form : | Lyophilized powder |
AA Sequence : | QEIGVSILKTDTPKGECKGKTASIGDYISLKYVGKFEDGTVFDSSEIHGGFSFNFTIGER KVIPGLEIGTINICEGEKRSIKIPYQLAYGENGIENAIPPRTDIYFDLEVVSIEGAPAQP FYYQLIPSVGTIIAFSMLAGFIVLVKFIIKRYPDESNSKKPAPGKPKKTKAAKQN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fkbp3 |
Synonyms | fkbp3; impA; DDB_G0285455; FK506-binding protein 3; Peptidyl-prolyl cis-trans isomerase; PPIase; Rotamase |
UniProt ID | Q54N80 |
◆ Recombinant Proteins | ||
FKBP3-4190H | Recombinant Human FKBP3 Protein, GST-tagged | +Inquiry |
Fkbp3-3026M | Recombinant Mouse Fkbp3 Protein, Myc/DDK-tagged | +Inquiry |
FKBP3-28917TH | Recombinant Human FKBP3, His-tagged | +Inquiry |
FKBP3-1251Z | Recombinant Zebrafish FKBP3 | +Inquiry |
FKBP3-9658H | Recombinant Human FKBP3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP3-6206HCL | Recombinant Human FKBP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All fkbp3 Products
Required fields are marked with *
My Review for All fkbp3 Products
Required fields are marked with *