Recombinant Full Length Dictyostelium Discoideum Signal Peptidase Complex Subunit 1(Spcs1) Protein, His-Tagged
| Cat.No. : | RFL21401DF |
| Product Overview : | Recombinant Full Length Dictyostelium discoideum Signal peptidase complex subunit 1(spcs1) Protein (Q54Y83) (1-80aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dictyostelium Discoideum |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-80) |
| Form : | Lyophilized powder |
| AA Sequence : | MDFEGQKLAEYIYQYTIIIFGVIGWIIGFIKQDFSITFYSVALGTFLSLILCLPNWKIYC QHPLSWQKPIVQSTPTDKSK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | spcs1 |
| Synonyms | spcs1; spc1; DDB_G0278371; Signal peptidase complex subunit 1 |
| UniProt ID | Q54Y83 |
| ◆ Recombinant Proteins | ||
| RFL21401DF | Recombinant Full Length Dictyostelium Discoideum Signal Peptidase Complex Subunit 1(Spcs1) Protein, His-Tagged | +Inquiry |
| SPCS1-8630M | Recombinant Mouse SPCS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SPCS1-4055C | Recombinant Chicken SPCS1 | +Inquiry |
| SPCS1-2910H | Recombinant Human SPCS1, GST-tagged | +Inquiry |
| RFL8324BF | Recombinant Full Length Bovine Signal Peptidase Complex Subunit 1(Spcs1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPCS1-1526HCL | Recombinant Human SPCS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All spcs1 Products
Required fields are marked with *
My Review for All spcs1 Products
Required fields are marked with *
