Recombinant Full Length Equine Herpesvirus 1 Glycoprotein K(Gk) Protein, His-Tagged
| Cat.No. : | RFL19015EF |
| Product Overview : | Recombinant Full Length Equine herpesvirus 1 Glycoprotein K(gK) Protein (P68334) (32-343aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | EHV1 |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (32-343) |
| Form : | Lyophilized powder |
| AA Sequence : | LHNPCVYATVSIDSKDGIAAKWEVYNSTIVYAYPENGAKRFSDGLSGFDYVCRENWVNES KLDVLKNMKELHDKVRIVVGTRNCRAYLWSVQLQMITGAWLIYIAFLCLRQERRLLGPFR NQNEFLSPTGYTFNYATYTLATTVLKTHYTKFALLLCEASLRRVALSRTFKRDPIGFLCE HSAALALIGLEVGTHFVARLLVVGTVTLVHTPCSQIYPIYLKLASWGFVVAVTIVEIVAI IYEKPPKTGSSANPPTPATHGVKGLCTSCCSTVLANLCGKLVYLLLVIGAVSILLHYEQR IQIGLLGESFSS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | gK |
| Synonyms | gK; ORF6; UL4; Envelope glycoprotein K; Syncytial protein |
| UniProt ID | P68334 |
| ◆ Recombinant Proteins | ||
| RFL25393HF | Recombinant Full Length Human Herpesvirus 1 Glycoprotein K(Gk) Protein, His-Tagged | +Inquiry |
| RFL6954VF | Recombinant Full Length Varicella-Zoster Virus Envelope Glycoprotein K(Gk) Protein, His-Tagged | +Inquiry |
| GK-5300HF | Recombinant Full Length Human GK Protein, GST-tagged | +Inquiry |
| GK-29028TH | Recombinant Human GK | +Inquiry |
| GK-414H | Recombinant Human GK | +Inquiry |
| ◆ Native Proteins | ||
| GK-01B | Active Recombinant Bacillus Stearothermo Glycerol Kinase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GK-5914HCL | Recombinant Human GK 293 Cell Lysate | +Inquiry |
| GK-5913HCL | Recombinant Human GK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All gK Products
Required fields are marked with *
My Review for All gK Products
Required fields are marked with *
