Recombinant Full Length Human GK Protein, GST-tagged
| Cat.No. : | GK-5300HF |
| Product Overview : | Human GK full-length ORF ( AAH37549, 1 a.a. - 524 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 524 amino acids |
| Description : | The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq |
| Molecular Mass : | 83.38 kDa |
| AA Sequence : | MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GK glycerol kinase [ Homo sapiens ] |
| Official Symbol | GK |
| Synonyms | glycerol kinase; 4289; Ensembl:ENSG00000198814; glycerol kinase;glycerokinase;ATP:glycerol 3-phosphotransferase; 2.7.1.30; GK1; GKD |
| Gene ID | 2710 |
| mRNA Refseq | NM_000167 |
| Protein Refseq | NP_000158 |
| MIM | 300474 |
| UniProt ID | B4DH54 |
| ◆ Native Proteins | ||
| GK-01B | Active Recombinant Bacillus Stearothermo Glycerol Kinase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GK-5914HCL | Recombinant Human GK 293 Cell Lysate | +Inquiry |
| GK-5913HCL | Recombinant Human GK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GK Products
Required fields are marked with *
My Review for All GK Products
Required fields are marked with *
