Recombinant Full Length Human 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Alpha(Agpat1) Protein, His-Tagged
Cat.No. : | RFL28606HF |
Product Overview : | Recombinant Full Length Human 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha(AGPAT1) Protein (Q99943) (27-283aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-283) |
Form : | Lyophilized powder |
AA Sequence : | FCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEV RGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIF IDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIV PIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREIS TDGRGGGDYLKKPGGGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AGPAT1 |
Synonyms | AGPAT1; G15; 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha; 1-acylglycerol-3-phosphate O-acyltransferase 1; 1-AGP acyltransferase 1; 1-AGPAT 1; Lysophosphatidic acid acyltransferase alpha; LPAAT-alpha; Protein G15 |
UniProt ID | Q99943 |
◆ Recombinant Proteins | ||
AGPAT1-271R | Recombinant Rhesus monkey AGPAT1 Protein, His-tagged | +Inquiry |
RFL15510OF | Recombinant Full Length Sheep 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Alpha(Agpat1) Protein, His-Tagged | +Inquiry |
AGPAT1-1417M | Recombinant Mouse AGPAT1 Protein | +Inquiry |
AGPAT1-99R | Recombinant Rhesus Macaque AGPAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AGPAT1-1000HF | Recombinant Full Length Human AGPAT1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGPAT1-36HCL | Recombinant Human AGPAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGPAT1 Products
Required fields are marked with *
My Review for All AGPAT1 Products
Required fields are marked with *