Recombinant Human AGPAT1 Protein, GST-tagged

Cat.No. : AGPAT1-427H
Product Overview : Human AGPAT1 full-length ORF ( NP_006402.1, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. This gene is located in the class III region of the human major histocompatibility complex. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
Molecular Mass : 58.1 kDa
AA Sequence : MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AGPAT1 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [ Homo sapiens ]
Official Symbol AGPAT1
Synonyms AGPAT1; 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha); 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha; LPAAT alpha; 1-AGPAT 1; 1-AGP acyltransferase 1; lysophospholipid acyltransferase; lysophosphatidic acid acyltransferase alpha; 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme A thiolase); G15; LPAATA; 1-AGPAT1; LPAAT-alpha; MGC4007; MGC5423;
Gene ID 10554
mRNA Refseq NM_006411
Protein Refseq NP_006402
MIM 603099
UniProt ID Q99943

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGPAT1 Products

Required fields are marked with *

My Review for All AGPAT1 Products

Required fields are marked with *

0
cart-icon