Recombinant Full Length Human 2-Acylglycerol O-Acyltransferase 3(Mogat3) Protein, His-Tagged
Cat.No. : | RFL13224HF |
Product Overview : | Recombinant Full Length Human 2-acylglycerol O-acyltransferase 3(MOGAT3) Protein (Q86VF5) (1-341aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-341) |
Form : | Lyophilized powder |
AA Sequence : | MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYL VWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMC TGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQ PQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRL KAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQR LHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MOGAT3 |
Synonyms | MOGAT3; DC7; DGAT2L7; UNQ9383/PRO34208; 2-acylglycerol O-acyltransferase 3; Acyl-CoA:monoacylglycerol acyltransferase 3; MGAT3; Diacylglycerol O-acyltransferase candidate 7; hDC7; Diacylglycerol acyltransferase 2-like protein 7; Monoacylglycerol O-acyltra |
UniProt ID | Q86VF5 |
◆ Recombinant Proteins | ||
RFL13224HF | Recombinant Full Length Human 2-Acylglycerol O-Acyltransferase 3(Mogat3) Protein, His-Tagged | +Inquiry |
MOGAT3-935H | Recombinant Human MOGAT3, His-tagged | +Inquiry |
MOGAT3-6305HF | Recombinant Full Length Human MOGAT3 Protein, GST-tagged | +Inquiry |
MOGAT3-5470H | Recombinant Human MOGAT3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOGAT3-4257HCL | Recombinant Human MOGAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOGAT3 Products
Required fields are marked with *
My Review for All MOGAT3 Products
Required fields are marked with *