Recombinant Full Length Human MOGAT3 Protein, GST-tagged

Cat.No. : MOGAT3-6305HF
Product Overview : Human MOGAT3 full-length ORF ( NP_835470.1, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 341 amino acids
Description : Acyl-CoA: monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA (Cheng et al., 2003 [PubMed 12618427]).[supplied by OMIM
Molecular Mass : 65.1 kDa
AA Sequence : MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQRLHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MOGAT3 monoacylglycerol O-acyltransferase 3 [ Homo sapiens ]
Official Symbol MOGAT3
Synonyms MOGAT3; monoacylglycerol O-acyltransferase 3; 2-acylglycerol O-acyltransferase 3; DC7; DGAT2L7; hDC7; acyl-CoA:monoacylglycerol acyltransferase 3; diacylglycerol O-acyltransferase candidate 7; diacylglycerol acyltransferase 2-like protein 7; acyl coenzyme A:monoacylglycerol acyltransferase 3; MGAT3; MGC119203; MGC119204;
Gene ID 346606
mRNA Refseq NM_178176
Protein Refseq NP_835470
MIM 610184
UniProt ID Q86VF5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOGAT3 Products

Required fields are marked with *

My Review for All MOGAT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon