Recombinant Full Length Human MOGAT3 Protein, GST-tagged
Cat.No. : | MOGAT3-6305HF |
Product Overview : | Human MOGAT3 full-length ORF ( NP_835470.1, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 341 amino acids |
Description : | Acyl-CoA: monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA (Cheng et al., 2003 [PubMed 12618427]).[supplied by OMIM |
Molecular Mass : | 65.1 kDa |
AA Sequence : | MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQRLHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MOGAT3 monoacylglycerol O-acyltransferase 3 [ Homo sapiens ] |
Official Symbol | MOGAT3 |
Synonyms | MOGAT3; monoacylglycerol O-acyltransferase 3; 2-acylglycerol O-acyltransferase 3; DC7; DGAT2L7; hDC7; acyl-CoA:monoacylglycerol acyltransferase 3; diacylglycerol O-acyltransferase candidate 7; diacylglycerol acyltransferase 2-like protein 7; acyl coenzyme A:monoacylglycerol acyltransferase 3; MGAT3; MGC119203; MGC119204; |
Gene ID | 346606 |
mRNA Refseq | NM_178176 |
Protein Refseq | NP_835470 |
MIM | 610184 |
UniProt ID | Q86VF5 |
◆ Recombinant Proteins | ||
MOGAT3-6305HF | Recombinant Full Length Human MOGAT3 Protein, GST-tagged | +Inquiry |
MOGAT3-935H | Recombinant Human MOGAT3, His-tagged | +Inquiry |
MOGAT3-5470H | Recombinant Human MOGAT3 Protein, GST-tagged | +Inquiry |
RFL13224HF | Recombinant Full Length Human 2-Acylglycerol O-Acyltransferase 3(Mogat3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOGAT3-4257HCL | Recombinant Human MOGAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOGAT3 Products
Required fields are marked with *
My Review for All MOGAT3 Products
Required fields are marked with *