Recombinant Full Length Human ACOT4 Protein, C-Flag-tagged
Cat.No. : | ACOT4-1806HFL |
Product Overview : | Recombinant Full Length Human ACOT4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables acyl-CoA hydrolase activity and succinyl-CoA hydrolase activity. Involved in carboxylic acid metabolic process; saturated monocarboxylic acid metabolic process; and succinyl-CoA metabolic process. Located in peroxisome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.1 kDa |
AA Sequence : | MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHARYCADARGELDLERAPALGG SFAGLEPMGLLWALEPEKPFWRFLKRDVQIPFVVELEVLDGHDPEPGRLLCQAQHERHFLPPGVRRQSVR AGRVRATLFLPPGPGPFPGIIDIFGIGGGLLEYRASLLAGHGFATLALAYYNFEDLPNNMDNISLEYFEE AVCYMLQHPQVKGPGIGLLGISLGADICLSMASFLKNVSATVSINGSGISGNTAINYKHSSIPPLGYDLR RIKVAFSGLVDIVDIRNALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKP QIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKTAVPK L myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Biosynthesis of unsaturated fatty acids |
Full Length : | Full L. |
Gene Name | ACOT4 acyl-CoA thioesterase 4 [ Homo sapiens (human) ] |
Official Symbol | ACOT4 |
Synonyms | PTE1B; PTE2B; PTE-Ib |
Gene ID | 122970 |
mRNA Refseq | NM_152331.4 |
Protein Refseq | NP_689544.3 |
MIM | 614314 |
UniProt ID | Q8N9L9 |
◆ Recombinant Proteins | ||
ACOT4-907H | Recombinant Human ACOT4 Protein, MYC/DDK-tagged | +Inquiry |
ACOT4-888H | Recombinant Human ACOT4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNFSF12-3282H | Recombinant Human TNFSF12 protein, His-tagged | +Inquiry |
ACOT4-1806HFL | Recombinant Full Length Human ACOT4 Protein, C-Flag-tagged | +Inquiry |
ACOT4-260H | Recombinant Human ACOT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACOT4 Products
Required fields are marked with *
My Review for All ACOT4 Products
Required fields are marked with *
0
Inquiry Basket