Recombinant Full Length Human ADH1B Protein, C-Flag-tagged
Cat.No. : | ADH1B-1428HFL |
Product Overview : | Recombinant Full Length Human ADH1B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This encoded protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.7 kDa |
AA Sequence : | MSTAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVTPLPVILGHEA AGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPIHH FLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVM GCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL LCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV LPFEKINEGFDLLHSGKSIRTVLTFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Drug metabolism - cytochrome P450, Fatty acid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism, Tyrosine metabolism |
Full Length : | Full L. |
Gene Name | ADH1B alcohol dehydrogenase 1B (class I), beta polypeptide [ Homo sapiens (human) ] |
Official Symbol | ADH1B |
Synonyms | ADH2; HEL-S-117 |
Gene ID | 125 |
mRNA Refseq | NM_000668.6 |
Protein Refseq | NP_000659.2 |
MIM | 103720 |
UniProt ID | P00325 |
◆ Recombinant Proteins | ||
ADH1B-0248H | Recombinant Human ADH1B Protein (S2-F375), Tag Free | +Inquiry |
ADH1B-26900TH | Recombinant Human ADH1B | +Inquiry |
ADH1B-1428HFL | Recombinant Full Length Human ADH1B Protein, C-Flag-tagged | +Inquiry |
ADH1B-0249H | Recombinant Human ADH1B Protein (S2-F375), GST tagged | +Inquiry |
ADH1B-246R | Recombinant Rhesus monkey ADH1B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADH1B-9014HCL | Recombinant Human ADH1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADH1B Products
Required fields are marked with *
My Review for All ADH1B Products
Required fields are marked with *
0
Inquiry Basket