Recombinant Full Length Human ADIRF Protein, Flag tagged

• Cat.No.: ADIRF-32HFL
• Product Overview: Recombinant protein of human chromosome 10 open reading frame 116 (C10orf116) with C-Flag tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293T
• Tag: Flag
• Protein Length: 1-76 aa
• Description: APM2 gene is exclusively expressed in adipose tissue. Its function is currently unknown.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Molecular Mass: 7.7 kDa
• AASequence: MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGKKFGLLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Concentration: >0.05 μg/μL as determined by microplate BCA method

Gene Information

• Gene Name: ADIRF adipogenesis regulatory factor [ Homo sapiens (human) ]
• Official Symbol: ADIRF
• Synonyms: ADIRF; adipogenesis regulatory factor; AFRO; APM2; apM-2; C10orf116; adipogenesis regulatory factor; adipogenesis factor rich in obesity; adipose most abundant gene transcript 2 protein; adipose specific 2; adipose-specific protein 2
• Gene ID: 10974
• mRNA Refseq: NM_006829
• Protein Refseq: NP_006820
• MIM: 621163
• UniProt ID: Q15847