Recombinant Full Length Human ADIRF Protein, Flag tagged

Cat.No. : ADIRF-32HFL
Product Overview : Recombinant protein of human chromosome 10 open reading frame 116 (C10orf116) with C-Flag tag was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293T
Tag : Flag
Protein Length : 1-76 aa
Description : APM2 gene is exclusively expressed in adipose tissue. Its function is currently unknown.
Form : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Molecular Mass : 7.7 kDa
AASequence : MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGKKFGLLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage : Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Concentration : >0.05 μg/μL as determined by microplate BCA method
Gene Name ADIRF adipogenesis regulatory factor [ Homo sapiens (human) ]
Official Symbol ADIRF
Synonyms ADIRF; adipogenesis regulatory factor; AFRO; APM2; apM-2; C10orf116; adipogenesis regulatory factor; adipogenesis factor rich in obesity; adipose most abundant gene transcript 2 protein; adipose specific 2; adipose-specific protein 2
Gene ID 10974
mRNA Refseq NM_006829
Protein Refseq NP_006820
MIM 621163
UniProt ID Q15847

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADIRF Products

Required fields are marked with *

My Review for All ADIRF Products

Required fields are marked with *

0
cart-icon
0
compare icon