Recombinant Full Length Human ALDH18A1 Protein, C-Flag-tagged
| Cat.No. : | ALDH18A1-896HFL |
| Product Overview : | Recombinant Full Length Human ALDH18A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene is a member of the aldehyde dehydrogenase family and encodes a bifunctional ATP- and NADPH-dependent mitochondrial enzyme with both gamma-glutamyl kinase and gamma-glutamyl phosphate reductase activities. The encoded protein catalyzes the reduction of glutamate to delta1-pyrroline-5-carboxylate, a critical step in the de novo biosynthesis of proline, ornithine and arginine. Mutations in this gene lead to hyperammonemia, hypoornithinemia, hypocitrullinemia, hypoargininemia and hypoprolinemia and may be associated with neurodegeneration, cataracts and connective tissue diseases. Alternatively spliced transcript variants, encoding different isoforms, have been described for this gene. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 87.1 kDa |
| AA Sequence : | MLSQVYRCGFQPFNQHLLPWVKCTTVFRSHCIQPSVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHA KRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQA LHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHEL LRMNIVPIVNTNDAVVPPAEPNSDLQGVNVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDD AKLIDIFYPGDQQSVTFGIKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVG TFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAA PLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDCLPQV AALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKEAVQLVNTREEVEDLCRLDKMIDLIIPRGS SQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVRDSKCEYPAACNALETLLIHRDLLRTPLF DQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKSLRTEYGDLELCIEVVDNVQDAIDHIHKYGSSHTDVIV TEDENTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGKDHV VSDFSEHGSLKYLHENLPIPQRNTNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome |
| Protein Pathways : | Arginine and proline metabolism, Metabolic pathways |
| Full Length : | Full L. |
| Gene Name | ALDH18A1 aldehyde dehydrogenase 18 family member A1 [ Homo sapiens (human) ] |
| Official Symbol | ALDH18A1 |
| Synonyms | GSAS; P5CS; PYCS; SPG9; ADCL3; SPG9A; SPG9B; ARCL3A |
| Gene ID | 5832 |
| mRNA Refseq | NM_002860.4 |
| Protein Refseq | NP_002851.2 |
| MIM | 138250 |
| UniProt ID | P54886 |
| ◆ Recombinant Proteins | ||
| Aldh18a1-1590M | Recombinant Mouse Aldh18a1 Protein, Myc/DDK-tagged | +Inquiry |
| ALDH18A1-9550H | Recombinant Human ALDH18A1 protein, His-tagged | +Inquiry |
| ALDH18A1-10H | Recombinant Human ALDH18A1 protein(1-795aa) | +Inquiry |
| ALDH18A1-310H | Recombinant Human ALDH18A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ALDH18A1-1517M | Recombinant Mouse ALDH18A1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALDH18A1 Products
Required fields are marked with *
My Review for All ALDH18A1 Products
Required fields are marked with *
