Recombinant Human ALDH18A1 protein, His-tagged
Cat.No. : | ALDH18A1-9550H |
Product Overview : | Recombinant Human ALDH18A1 protein(153-501 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 153-501 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | TYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS |
Gene Name | ALDH18A1 aldehyde dehydrogenase 18 family, member A1 [ Homo sapiens ] |
Official Symbol | ALDH18A1 |
Synonyms | ALDH18A1; aldehyde dehydrogenase 18 family, member A1; GSAS, PYCS, pyrroline 5 carboxylate synthetase (glutamate gamma semialdehyde synthetase); delta-1-pyrroline-5-carboxylate synthase; P5CS; delta1-pyrroline-5-carboxlate synthetase; aldehyde dehydrogenase family 18 member A1; delta-1-pyrroline-5-carboxylate synthetase; pyrroline-5-carboxylate synthetase (glutamate gamma-semialdehyde synthetase); GSAS; PYCS; ARCL3A; MGC117316; |
Gene ID | 5832 |
mRNA Refseq | NM_001017423 |
Protein Refseq | NP_001017423 |
MIM | 138250 |
UniProt ID | P54886 |
◆ Recombinant Proteins | ||
ALDH18A1-896HFL | Recombinant Full Length Human ALDH18A1 Protein, C-Flag-tagged | +Inquiry |
ALDH18A1-10H | Recombinant Human ALDH18A1 protein(1-795aa) | +Inquiry |
ALDH18A1-1517M | Recombinant Mouse ALDH18A1 Protein | +Inquiry |
ALDH18A1-310H | Recombinant Human ALDH18A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALDH18A1-2882H | Recombinant Human ALDH18A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALDH18A1 Products
Required fields are marked with *
My Review for All ALDH18A1 Products
Required fields are marked with *