Recombinant Full Length Human ALKBH7 Protein, C-Flag-tagged

• Cat.No.: ALKBH7-2088HFL
• Product Overview: Recombinant Full Length Human ALKBH7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to enable dioxygenase activity and metal ion binding activity. Involved in cellular response to DNA damage stimulus and regulation of mitochondrial membrane permeability involved in programmed necrotic cell death. Located in mitochondrial matrix.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 24.3 kDa
• AA Sequence: MAGTGLLALRTLPGPSWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAI HGFRETEKSRWSEASRAILQRVQAAAFGPGQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSP SVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMG PGESGQPPPAC myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: ALKBH7 alkB homolog 7 [ Homo sapiens (human) ]
• Official Symbol: ALKBH7
• Synonyms: ABH7; SPATA11; UNQ6002
• Gene ID: 84266
• mRNA Refseq: NM_032306.4
• Protein Refseq: NP_115682.1
• MIM: 613305
• UniProt ID: Q9BT30