Recombinant Full Length Human ALKBH7 Protein, C-Flag-tagged

Cat.No. : ALKBH7-2088HFL
Product Overview : Recombinant Full Length Human ALKBH7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Predicted to enable dioxygenase activity and metal ion binding activity. Involved in cellular response to DNA damage stimulus and regulation of mitochondrial membrane permeability involved in programmed necrotic cell death. Located in mitochondrial matrix.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 24.3 kDa
AA Sequence : MAGTGLLALRTLPGPSWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAI HGFRETEKSRWSEASRAILQRVQAAAFGPGQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSP SVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMG PGESGQPPPAC myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name ALKBH7 alkB homolog 7 [ Homo sapiens (human) ]
Official Symbol ALKBH7
Synonyms ABH7; SPATA11; UNQ6002
Gene ID 84266
mRNA Refseq NM_032306.4
Protein Refseq NP_115682.1
MIM 613305
UniProt ID Q9BT30

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALKBH7 Products

Required fields are marked with *

My Review for All ALKBH7 Products

Required fields are marked with *

0
cart-icon