Recombinant Full Length Human ANAPC10 Protein, C-Flag-tagged

Cat.No. : ANAPC10-2092HFL
Product Overview : Recombinant Full Length Human ANAPC10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 21.1 kDa
AA Sequence : MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRR KTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIA VLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis
Full Length : Full L.
Gene Name ANAPC10 anaphase promoting complex subunit 10 [ Homo sapiens (human) ]
Official Symbol ANAPC10
Synonyms DOC1; APC10
Gene ID 10393
mRNA Refseq NM_014885.5
Protein Refseq NP_055700.2
MIM 613745
UniProt ID Q9UM13

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANAPC10 Products

Required fields are marked with *

My Review for All ANAPC10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon