Recombinant Full Length Human ANAPC10 Protein, C-Flag-tagged
Cat.No. : | ANAPC10-2092HFL |
Product Overview : | Recombinant Full Length Human ANAPC10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.1 kDa |
AA Sequence : | MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRR KTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIA VLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | ANAPC10 anaphase promoting complex subunit 10 [ Homo sapiens (human) ] |
Official Symbol | ANAPC10 |
Synonyms | DOC1; APC10 |
Gene ID | 10393 |
mRNA Refseq | NM_014885.5 |
Protein Refseq | NP_055700.2 |
MIM | 613745 |
UniProt ID | Q9UM13 |
◆ Recombinant Proteins | ||
ANAPC10-1120HF | Recombinant Full Length Human ANAPC10 Protein, GST-tagged | +Inquiry |
Anapc10-1619M | Recombinant Mouse Anapc10 Protein, Myc/DDK-tagged | +Inquiry |
ANAPC10-1845C | Recombinant Chicken ANAPC10 | +Inquiry |
ANAPC10-9634H | Recombinant Human ANAPC10, His-tagged | +Inquiry |
ANAPC10-2092HFL | Recombinant Full Length Human ANAPC10 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC10-8871HCL | Recombinant Human ANAPC10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANAPC10 Products
Required fields are marked with *
My Review for All ANAPC10 Products
Required fields are marked with *
0
Inquiry Basket