Recombinant Human ANAPC10 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ANAPC10-5701H |
Product Overview : | ANAPC10 MS Standard C13 and N15-labeled recombinant protein (NP_055700) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1), the activating subunit of cyclin-dependent kinase-1 (CDK1). |
Molecular Mass : | 21.3 kDa |
AA Sequence : | MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ANAPC10 anaphase promoting complex subunit 10 [ Homo sapiens (human) ] |
Official Symbol | ANAPC10 |
Synonyms | ANAPC10; anaphase promoting complex subunit 10; anaphase-promoting complex subunit 10; APC10; DKFZP564L0562; DOC1; cyclosome subunit 10; DKFZp564L0562; |
Gene ID | 10393 |
mRNA Refseq | NM_014885 |
Protein Refseq | NP_055700 |
MIM | 613745 |
UniProt ID | Q9UM13 |
◆ Recombinant Proteins | ||
ANAPC10-8244Z | Recombinant Zebrafish ANAPC10 | +Inquiry |
ANAPC10-337H | Recombinant Human ANAPC10 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANAPC10-5701H | Recombinant Human ANAPC10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ANAPC10-1120HF | Recombinant Full Length Human ANAPC10 Protein, GST-tagged | +Inquiry |
ANAPC10-541H | Recombinant Human ANAPC10 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC10-8871HCL | Recombinant Human ANAPC10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANAPC10 Products
Required fields are marked with *
My Review for All ANAPC10 Products
Required fields are marked with *
0
Inquiry Basket