Recombinant Human ANAPC10 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ANAPC10-5701H
Product Overview : ANAPC10 MS Standard C13 and N15-labeled recombinant protein (NP_055700) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1), the activating subunit of cyclin-dependent kinase-1 (CDK1).
Molecular Mass : 21.3 kDa
AA Sequence : MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ANAPC10 anaphase promoting complex subunit 10 [ Homo sapiens (human) ]
Official Symbol ANAPC10
Synonyms ANAPC10; anaphase promoting complex subunit 10; anaphase-promoting complex subunit 10; APC10; DKFZP564L0562; DOC1; cyclosome subunit 10; DKFZp564L0562;
Gene ID 10393
mRNA Refseq NM_014885
Protein Refseq NP_055700
MIM 613745
UniProt ID Q9UM13

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANAPC10 Products

Required fields are marked with *

My Review for All ANAPC10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon