Recombinant Full Length Human ANXA1 Protein, C-Flag-tagged
Cat.No. : | ANXA1-160HFL |
Product Overview : | Recombinant Full Length Human ANXA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a membrane-localized protein that binds phospholipids. This protein inhibits phospholipase A2 and has anti-inflammatory activity. Loss of function or expression of this gene has been detected in multiple tumors. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.5 kDa |
AA Sequence : | MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILT KRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEI LASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFRNALLSLAKGDRSEDFGVNEDLADSDARALYEAG ERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAE KLHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCGGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | ANXA1 annexin A1 [ Homo sapiens (human) ] |
Official Symbol | ANXA1 |
Synonyms | ANX1; LPC1 |
Gene ID | 301 |
mRNA Refseq | NM_000700.3 |
Protein Refseq | NP_000691.1 |
MIM | 151690 |
UniProt ID | P04083 |
◆ Recombinant Proteins | ||
ANXA1-001H | Recombinant Human ANXA1 Protein, His-tagged | +Inquiry |
ANXA1-1039HF | Recombinant Full Length Human ANXA1 Protein, GST-tagged | +Inquiry |
ANXA1-1725H | Recombinant Human ANXA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ANXA1-688R | Recombinant Rat ANXA1 Protein | +Inquiry |
ANXA1-33H | Active Recombinant Human ANXA1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA1-8839HCL | Recombinant Human ANXA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANXA1 Products
Required fields are marked with *
My Review for All ANXA1 Products
Required fields are marked with *
0
Inquiry Basket