Recombinant Full Length Human APOO Protein, Flag tagged

• Cat.No.: APOO-23HFL
• Product Overview: Recombinant full length protein of human apolipoprotein O (APOO), transcript variant 1 with Flag tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293T
• Tag: Flag
• Protein Length: 1-198 aa
• Description: This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Molecular Mass: 19.7 kDa
• AASequence: MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHYCEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Concentration: > 0.05 μg/μL as determined by microplate BCA method
• Shipping: Dry Ice

Gene Information

• Gene Name: APOO apolipoprotein O [ Homo sapiens (human) ]
• Official Symbol: APOO
• Synonyms: APOO; apolipoprotein O; MIC26; Mic23; My025; FAM121B; MICOS26; MICOS complex subunit MIC26; MICOS complex subunit MIC23; brain my025; family with sequence similarity 121B; mitochondrial contact site and cristae organizing system subunit 26
• Gene ID: 79135
• mRNA Refseq: NM_024122
• Protein Refseq: NP_077027
• MIM: 300753
• UniProt ID: Q9BUR5