Recombinant Full Length Human ARHGDIB Protein, C-Flag-tagged
Cat.No. : | ARHGDIB-63HFL |
Product Overview : | Recombinant Full Length Human ARHGDIB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Members of the Rho (or ARH) protein family (see MIM 165390) and other Ras-related small GTP-binding proteins (see MIM 179520) are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases (summary by Scherle et al., 1993 [PubMed 8356058]). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 22.8 kDa |
AA Sequence : | MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVT RLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKAT FMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Neurotrophin signaling pathway |
Full Length : | Full L. |
Gene Name | ARHGDIB Rho GDP dissociation inhibitor beta [ Homo sapiens (human) ] |
Official Symbol | ARHGDIB |
Synonyms | D4; GDIA2; GDID4; LYGDI; Ly-GDI; RAP1GN1; RhoGDI2 |
Gene ID | 397 |
mRNA Refseq | NM_001175.7 |
Protein Refseq | NP_001166.3 |
MIM | 602843 |
UniProt ID | P52566 |
◆ Recombinant Proteins | ||
ARHGDIB-689M | Recombinant Mouse ARHGDIB Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGDIB-374H | Recombinant Human ARHGDIB Protein, His (Fc)-Avi-tagged | +Inquiry |
Arhgdib-646M | Recombinant Mouse Arhgdib Protein, MYC/DDK-tagged | +Inquiry |
ARHGDIB-4780C | Recombinant Chicken ARHGDIB | +Inquiry |
ARHGDIB-27088TH | Recombinant Human ARHGDIB, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGDIB-8735HCL | Recombinant Human ARHGDIB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGDIB Products
Required fields are marked with *
My Review for All ARHGDIB Products
Required fields are marked with *
0
Inquiry Basket