Recombinant Human ARHGDIB protein, His-tagged
| Cat.No. : | ARHGDIB-3500H |
| Product Overview : | Recombinant Human ARHGDIB protein(1-201 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | July 10, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-201 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ARHGDIB Rho GDP dissociation inhibitor (GDI) beta [ Homo sapiens ] |
| Official Symbol | ARHGDIB |
| Synonyms | ARHGDIB; Rho GDP dissociation inhibitor (GDI) beta; GDIA2, GDID4, RAP1GN1; rho GDP-dissociation inhibitor 2; Ly GDI; RhoGDI2; Rho GDI 2; rho-GDI beta; D4; GDIA2; GDID4; LYGDI; Ly-GDI; RAP1GN1; |
| Gene ID | 397 |
| mRNA Refseq | NM_001175 |
| Protein Refseq | NP_001166 |
| MIM | 602843 |
| UniProt ID | P52566 |
| ◆ Recombinant Proteins | ||
| ARHGDIB-689M | Recombinant Mouse ARHGDIB Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARHGDIB-27088TH | Recombinant Human ARHGDIB, GST-tagged | +Inquiry |
| ARHGDIB-3500H | Recombinant Human ARHGDIB protein, His-tagged | +Inquiry |
| ARHGDIB-0399H | Recombinant Human ARHGDIB Protein (Thr2-Glu201), N-His-tagged | +Inquiry |
| ARHGDIB-21H | Recombinant Human ARHGDIB protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARHGDIB-8735HCL | Recombinant Human ARHGDIB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGDIB Products
Required fields are marked with *
My Review for All ARHGDIB Products
Required fields are marked with *




