Recombinant Human ARHGDIB protein, His-tagged
Cat.No. : | ARHGDIB-3500H |
Product Overview : | Recombinant Human ARHGDIB protein(1-201 aa), fused to His tag, was expressed in E. coli. |
Availability | July 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-201 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ARHGDIB Rho GDP dissociation inhibitor (GDI) beta [ Homo sapiens ] |
Official Symbol | ARHGDIB |
Synonyms | ARHGDIB; Rho GDP dissociation inhibitor (GDI) beta; GDIA2, GDID4, RAP1GN1; rho GDP-dissociation inhibitor 2; Ly GDI; RhoGDI2; Rho GDI 2; rho-GDI beta; D4; GDIA2; GDID4; LYGDI; Ly-GDI; RAP1GN1; |
Gene ID | 397 |
mRNA Refseq | NM_001175 |
Protein Refseq | NP_001166 |
MIM | 602843 |
UniProt ID | P52566 |
◆ Recombinant Proteins | ||
ARHGDIB-775H | Recombinant Human ARHGDIB protein, GST-tagged | +Inquiry |
ARHGDIB-1193H | Recombinant Human ARHGDIB protein, His & GST-tagged | +Inquiry |
ARHGDIB-1884M | Recombinant Mouse ARHGDIB Protein | +Inquiry |
ARHGDIB-689M | Recombinant Mouse ARHGDIB Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGDIB-4780C | Recombinant Chicken ARHGDIB | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGDIB-8735HCL | Recombinant Human ARHGDIB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGDIB Products
Required fields are marked with *
My Review for All ARHGDIB Products
Required fields are marked with *