Recombinant Full Length Human ASPDH Protein, GST-tagged
Cat.No. : | ASPDH-5906HF |
Product Overview : | Human LOC554235 full-length ORF ( NP_001019827.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 178 amino acids |
Description : | ASPDH (Aspartate Dehydrogenase Domain Containing) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity and aspartate dehydrogenase activity. |
Molecular Mass : | 45.1 kDa |
AA Sequence : | MGDRVKGSKSRRPDLVVEVAHPKIIHESGAQILRHANLLSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWRSLLACCQLPSRPGIHLC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASPDH aspartate dehydrogenase domain containing [ Homo sapiens (human) ] |
Official Symbol | ASPDH |
Synonyms | ASPDH; aspartate dehydrogenase domain containing; putative L-aspartate dehydrogenase; aspartate dehydrogenase domain-containing protein; EC 1.4.1.21 |
Gene ID | 554235 |
mRNA Refseq | NM_001024656 |
Protein Refseq | NP_001019827 |
UniProt ID | A6ND91 |
◆ Recombinant Proteins | ||
ASPDH-5906HF | Recombinant Full Length Human ASPDH Protein, GST-tagged | +Inquiry |
ASPDH-1370Z | Recombinant Zebrafish ASPDH | +Inquiry |
Aspdh-1748M | Recombinant Mouse Aspdh Protein, Myc/DDK-tagged | +Inquiry |
Aspdh-5879M | Recombinant Mouse Aspdh protein, His&Myc-tagged | +Inquiry |
ASPDH-4770H | Recombinant Human ASPDH Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASPDH-8646HCL | Recombinant Human ASPDH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASPDH Products
Required fields are marked with *
My Review for All ASPDH Products
Required fields are marked with *