Recombinant Human ASPDH Protein, GST-tagged
| Cat.No. : | ASPDH-4770H |
| Product Overview : | Human LOC554235 full-length ORF ( NP_001019827.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ASPDH (Aspartate Dehydrogenase Domain Containing) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity and aspartate dehydrogenase activity. |
| Molecular Mass : | 45.1 kDa |
| AA Sequence : | MGDRVKGSKSRRPDLVVEVAHPKIIHESGAQILRHANLLSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWRSLLACCQLPSRPGIHLC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ASPDH aspartate dehydrogenase domain containing [ Homo sapiens (human) ] |
| Official Symbol | ASPDH |
| Synonyms | ASPDH; aspartate dehydrogenase domain containing; putative L-aspartate dehydrogenase; aspartate dehydrogenase domain-containing protein; EC 1.4.1.21 |
| Gene ID | 554235 |
| mRNA Refseq | NM_001024656 |
| Protein Refseq | NP_001019827 |
| UniProt ID | A6ND91 |
| ◆ Recombinant Proteins | ||
| ASPDH-2037M | Recombinant Mouse ASPDH Protein | +Inquiry |
| Aspdh-5879M | Recombinant Mouse Aspdh protein, His&Myc-tagged | +Inquiry |
| ASPDH-5906HF | Recombinant Full Length Human ASPDH Protein, GST-tagged | +Inquiry |
| Aspdh-1748M | Recombinant Mouse Aspdh Protein, Myc/DDK-tagged | +Inquiry |
| ASPDH-4770H | Recombinant Human ASPDH Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ASPDH-8646HCL | Recombinant Human ASPDH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASPDH Products
Required fields are marked with *
My Review for All ASPDH Products
Required fields are marked with *




