Recombinant Full Length Human ATP6AP1L Protein, GST-tagged

• Cat.No.: ATP6AP1L-5942HF
• Product Overview: Human LOC92270 full-length ORF (1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 224 amino acids
• Description: ATP6AP1L (ATPase H+ Transporting Accessory Protein 1 Like) is a Protein Coding gene. GO annotations related to this gene include proton-transporting ATPase activity, rotational mechanism and proton-transporting ATP synthase activity, rotational mechanism. An important paralog of this gene is ATP6AP1.
• Molecular Mass: 51.7 kDa
• AA Sequence: MRLWKARVLKLVLKTAKDSRLGLNSKWLSLKLGDAGNPRSLAIRFILTNYNKLSIQSWFSLRRVEIISNNSIQAVFNPTGVYAPSGYSYRCQRVGSLQQDQALLLPSDTDDGSSLWEVTFIDFQIQGFAIKGGRFTKAQDCASSFSPAFLIGLAMSLILLLVLAYALHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAECYKLRSQQISKIYV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP6AP1L ATPase H+ transporting accessory protein 1 like [ Homo sapiens (human) ]
• Official Symbol: ATP6AP1L
• Synonyms: ATP6AP1L; ATPase H+ transporting accessory protein 1 like; V-type proton ATPase subunit S1-like protein; ATPase, H+ transporting, lysosomal accessory protein 1-like; vacuolar proton pump subunit S1-like protein
• Gene ID: 92270
• mRNA Refseq: NM_001017971
• Protein Refseq: NP_001017971
• UniProt ID: Q52LC2