Recombinant Full Length Human ATXN3 Protein, C-Flag-tagged
Cat.No. : | ATXN3-1896HFL |
Product Overview : | Recombinant Full Length Human ATXN3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 12-44 to 52-86 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 41.1 kDa |
AA Sequence : | MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMD DSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGP ELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLKEQRVHKTDLE RVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEE LRKRREAYFEKQQQKQQQQQQQQQQGDLSGQSSHPCERPATSSGALGSDLGDAMSEEDMLQAAVTMSLET VRNDLKTEGKK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | ATXN3 ataxin 3 [ Homo sapiens (human) ] |
Official Symbol | ATXN3 |
Synonyms | AT3; JOS; MJD; ATX3; MJD1; SCA3 |
Gene ID | 4287 |
mRNA Refseq | NM_004993.6 |
Protein Refseq | NP_004984.2 |
MIM | 607047 |
UniProt ID | P54252 |
◆ Recombinant Proteins | ||
ATXN3-173H | Active Recombinant Human ATXN3, GST-tagged | +Inquiry |
ATXN3-5928C | Recombinant Chicken ATXN3 | +Inquiry |
ATXN3-902R | Recombinant Rat ATXN3 Protein | +Inquiry |
ATXN3-410H | Recombinant Human ATXN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATXN3-558R | Recombinant Rat ATXN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATXN3-52HCL | Recombinant Human ATXN3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATXN3 Products
Required fields are marked with *
My Review for All ATXN3 Products
Required fields are marked with *
0
Inquiry Basket