Recombinant Full Length Human BATF3 Protein, C-Flag-tagged

Cat.No. : BATF3-1293HFL
Product Overview : Recombinant Full Length Human BATF3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 14.3 kDa
AA Sequence : MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESL
EQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name BATF3 basic leucine zipper ATF-like transcription factor 3 [ Homo sapiens (human) ]
Official Symbol BATF3
Synonyms JDP1; SNFT; JUNDM1
Gene ID 55509
mRNA Refseq NM_018664.3
Protein Refseq NP_061134.1
MIM 612470
UniProt ID Q9NR55

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BATF3 Products

Required fields are marked with *

My Review for All BATF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon