Recombinant Full Length Human BATF3 Protein, C-Flag-tagged
| Cat.No. : | BATF3-1293HFL |
| Product Overview : | Recombinant Full Length Human BATF3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 14.3 kDa |
| AA Sequence : | MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESL EQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | BATF3 basic leucine zipper ATF-like transcription factor 3 [ Homo sapiens (human) ] |
| Official Symbol | BATF3 |
| Synonyms | JDP1; SNFT; JUNDM1 |
| Gene ID | 55509 |
| mRNA Refseq | NM_018664.3 |
| Protein Refseq | NP_061134.1 |
| MIM | 612470 |
| UniProt ID | Q9NR55 |
| ◆ Recombinant Proteins | ||
| BATF3-2261H | Recombinant Human BATF3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BATF3-5069H | Recombinant Human BATF3, His-tagged | +Inquiry |
| BATF3-603R | Recombinant Rat BATF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BATF3-945R | Recombinant Rat BATF3 Protein | +Inquiry |
| BATF3-1293HFL | Recombinant Full Length Human BATF3 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BATF3-1656HCL | Recombinant Human BATF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BATF3 Products
Required fields are marked with *
My Review for All BATF3 Products
Required fields are marked with *
