Recombinant Full Length Human BCAP29 Protein, C-Flag-tagged
| Cat.No. : | BCAP29-1686HFL |
| Product Overview : | Recombinant Full Length Human BCAP29 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Involved in osteoblast differentiation. Located in membrane. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 28.1 kDa |
| AA Sequence : | MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREV RKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQ AENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKM QSERLSKEYDQLLKEHSELQDRLERGNKKRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Transmembrane |
| Full Length : | Full L. |
| Gene Name | BCAP29 B cell receptor associated protein 29 [ Homo sapiens (human) ] |
| Official Symbol | BCAP29 |
| Synonyms | B29; BAP29 |
| Gene ID | 55973 |
| mRNA Refseq | NM_018844.4 |
| Protein Refseq | NP_061332.2 |
| MIM | 619612 |
| UniProt ID | Q9UHQ4 |
| ◆ Cell & Tissue Lysates | ||
| BCAP29-161HCL | Recombinant Human BCAP29 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAP29 Products
Required fields are marked with *
My Review for All BCAP29 Products
Required fields are marked with *
