Recombinant Full Length Human BCAP29 Protein, C-Flag-tagged

Cat.No. : BCAP29-1686HFL
Product Overview : Recombinant Full Length Human BCAP29 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Involved in osteoblast differentiation. Located in membrane.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 28.1 kDa
AA Sequence : MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREV RKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQ AENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKM
QSERLSKEYDQLLKEHSELQDRLERGNKKRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Transmembrane
Full Length : Full L.
Gene Name BCAP29 B cell receptor associated protein 29 [ Homo sapiens (human) ]
Official Symbol BCAP29
Synonyms B29; BAP29
Gene ID 55973
mRNA Refseq NM_018844.4
Protein Refseq NP_061332.2
MIM 619612
UniProt ID Q9UHQ4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCAP29 Products

Required fields are marked with *

My Review for All BCAP29 Products

Required fields are marked with *

0
cart-icon
0
compare icon