Recombinant Full Length Human BEND4 Protein, GST-tagged
Cat.No. : | BEND4-2598HF |
Product Overview : | Human CCDC4 full-length ORF (AAI46594.1, 1 a.a. - 416 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 416 amino acids |
Description : | BEND4 (BEN Domain Containing 4) is a Protein Coding gene. |
Molecular Mass : | 72.71 kDa |
AA Sequence : | MQGAPRARFGSRTPPAAAASSSSPSCTPATSQGHLRTPAQPPPASPAASSSSSFAAVVRYGPGAAAAAGTGGTGSDSASLELSAESRMILDAFAQQCSRVLSLLNCGGKLLDSNHSQSMISCVKQEGSSYNERQEHCHIGKGVHSQTSDNVDIEMQYMQRKQQTSAFLRVFTDSLQNYLLSGSFPTPNPSSASEYGHLADVDPLSTSPVHTLGGWTSPATSESHGHPSSSTLPEEEEEEDEEGYCPRCQELEQEVISLQQENEELRRKLESIPVPCQTVLDYLKMVLQHHNQLLIPQPADQPTEGSKQLLNNYPVYITSKQWDEAVNSSKKDGRRLLRYLIRFVFTTDELKYSCGLGKRKRSVQSGETGPERRPLDPVKVTCLRGTASFRSVSPSVISFHRIGCGSPRTSVQPSVF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BEND4 BEN domain containing 4 [ Homo sapiens ] |
Official Symbol | BEND4 |
Synonyms | BEND4; BEN domain containing 4; CCDC4, coiled coil domain containing 4; BEN domain-containing protein 4; FLJ35632; FLJ43965; coiled-coil domain containing 4; coiled-coil domain-containing protein 4; CCDC4; MGC157807; MGC157808; |
Gene ID | 389206 |
mRNA Refseq | NM_001159547 |
Protein Refseq | NP_001153019 |
UniProt ID | Q6ZU67 |
◆ Recombinant Proteins | ||
BEND4-2598HF | Recombinant Full Length Human BEND4 Protein, GST-tagged | +Inquiry |
BEND4-0015H | Recombinant Human BEND4 Protein, GST-Tagged | +Inquiry |
BEND4-2372M | Recombinant Mouse BEND4 Protein | +Inquiry |
BEND4-1009M | Recombinant Mouse BEND4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BEND4-295HCL | Recombinant Human BEND4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BEND4 Products
Required fields are marked with *
My Review for All BEND4 Products
Required fields are marked with *