Recombinant Human BEND4 Protein, GST-Tagged

Cat.No. : BEND4-0015H
Product Overview : Human CCDC4 full-length ORF (AAI46594.1, 1 a.a. - 416 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : BEND4 (BEN Domain Containing 4) is a Protein Coding gene.
Molecular Mass : 72.71 kDa
AA Sequence : MQGAPRARFGSRTPPAAAASSSSPSCTPATSQGHLRTPAQPPPASPAASSSSSFAAVVRYGPGAAAAAGTGGTGSDSASLELSAESRMILDAFAQQCSRVLSLLNCGGKLLDSNHSQSMISCVKQEGSSYNERQEHCHIGKGVHSQTSDNVDIEMQYMQRKQQTSAFLRVFTDSLQNYLLSGSFPTPNPSSASEYGHLADVDPLSTSPVHTLGGWTSPATSESHGHPSSSTLPEEEEEEDEEGYCPRCQELEQEVISLQQENEELRRKLESIPVPCQTVLDYLKMVLQHHNQLLIPQPADQPTEGSKQLLNNYPVYITSKQWDEAVNSSKKDGRRLLRYLIRFVFTTDELKYSCGLGKRKRSVQSGETGPERRPLDPVKVTCLRGTASFRSVSPSVISFHRIGCGSPRTSVQPSVF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BEND4 BEN domain containing 4 [ Homo sapiens ]
Official Symbol BEND4
Synonyms BEND4; BEN domain containing 4; CCDC4, coiled coil domain containing 4; BEN domain-containing protein 4; FLJ35632; FLJ43965; coiled-coil domain containing 4; coiled-coil domain-containing protein 4; CCDC4; MGC157807; MGC157808;
Gene ID 389206
mRNA Refseq NM_001159547
Protein Refseq NP_001153019
UniProt ID Q6ZU67

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BEND4 Products

Required fields are marked with *

My Review for All BEND4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon