Recombinant Full Length Human Beta-1,3-N-Acetylglucosaminyltransferase Manic Fringe(Mfng) Protein, His-Tagged
Cat.No. : | RFL4411HF |
Product Overview : | Recombinant Full Length Human Beta-1,3-N-acetylglucosaminyltransferase manic fringe(MFNG) Protein (O00587) (1-321aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-321) |
Form : | Lyophilized powder |
AA Sequence : | MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MFNG |
Synonyms | MFNG; Beta-1,3-N-acetylglucosaminyltransferase manic fringe; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase |
UniProt ID | O00587 |
◆ Recombinant Proteins | ||
Mfng-1882R | Recombinant Rat Mfng protein, His & T7-tagged | +Inquiry |
MFNG-4545H | Recombinant Human MFNG Protein (Ser80-Pro316), N-His tagged | +Inquiry |
MFNG-6198HF | Recombinant Full Length Human MFNG Protein, GST-tagged | +Inquiry |
MFNG-5517M | Recombinant Mouse MFNG Protein, His (Fc)-Avi-tagged | +Inquiry |
Mfng-1881M | Recombinant Mouse Mfng protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFNG-4346HCL | Recombinant Human MFNG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFNG Products
Required fields are marked with *
My Review for All MFNG Products
Required fields are marked with *
0
Inquiry Basket