Recombinant Full Length Human Beta-1,4-Galactosyltransferase 2(B4Galt2) Protein, His-Tagged
Cat.No. : | RFL18987HF |
Product Overview : | Recombinant Full Length Human Beta-1,4-galactosyltransferase 2(B4GALT2) Protein (O60909) (1-372aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-372) |
Form : | Lyophilized powder |
AA Sequence : | MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSARGPAHALHPAASSSSSSSNCSRPNATASSSGLPEVPSALPGPTAPTLPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPPSWPPRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | B4GALT2 |
Synonyms | B4GALT2; Beta-1,4-galactosyltransferase 2; Beta-1,4-GalTase 2; Beta4Gal-T2; b4Gal-T2; Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase; Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase; Lactose synthase A protein; N- |
UniProt ID | O60909 |
◆ Recombinant Proteins | ||
B4galt2-11HCL | Recombinant Mouse B4galt2 overexpression lysate | +Inquiry |
B4GALT2-029H | Recombinant Human B4GALT2 protein, GST-tagged | +Inquiry |
B4GALT2-2528H | Recombinant Human B4GALT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
B4GALT2-6886Z | Recombinant Zebrafish B4GALT2 | +Inquiry |
B4GALT2-6757C | Recombinant Chicken B4GALT2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
B4GALT2-8539HCL | Recombinant Human B4GALT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B4GALT2 Products
Required fields are marked with *
My Review for All B4GALT2 Products
Required fields are marked with *
0
Inquiry Basket