Recombinant Full Length Human Beta-1,4-Galactosyltransferase 2(B4Galt2) Protein, His-Tagged
| Cat.No. : | RFL18987HF |
| Product Overview : | Recombinant Full Length Human Beta-1,4-galactosyltransferase 2(B4GALT2) Protein (O60909) (1-372aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-372) |
| Form : | Lyophilized powder |
| AA Sequence : | MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSARGPAHALHPAASSSSSSSNCSRPNATASSSGLPEVPSALPGPTAPTLPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPPSWPPRG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | B4GALT2 |
| Synonyms | B4GALT2; Beta-1,4-galactosyltransferase 2; Beta-1,4-GalTase 2; Beta4Gal-T2; b4Gal-T2; Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase; Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase; Lactose synthase A protein; N- |
| UniProt ID | O60909 |
| ◆ Recombinant Proteins | ||
| B4GALT2-1653HF | Recombinant Full Length Human B4GALT2 Protein, GST-tagged | +Inquiry |
| RFL18987HF | Recombinant Full Length Human Beta-1,4-Galactosyltransferase 2(B4Galt2) Protein, His-Tagged | +Inquiry |
| B4GALT2-2528H | Recombinant Human B4GALT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| B4GALT2-6757C | Recombinant Chicken B4GALT2 | +Inquiry |
| B4GALT2-1008H | Active Recombinant Human B4GALT2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| B4GALT2-8539HCL | Recombinant Human B4GALT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B4GALT2 Products
Required fields are marked with *
My Review for All B4GALT2 Products
Required fields are marked with *
