Recombinant Full Length Human BPHL Protein, GST-tagged
| Cat.No. : | BPHL-3770HF | 
| Product Overview : | Human BPHL full-length ORF ( NP_004323.1, 1 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 274 amino acids | 
| Description : | This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described. | 
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Molecular Mass : | 57.5 kDa | 
| AA Sequence : | MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | BPHL biphenyl hydrolase-like (serine hydrolase) [ Homo sapiens ] | 
| Official Symbol | BPHL | 
| Synonyms | BPHL; biphenyl hydrolase-like (serine hydrolase); MCNAA; valacyclovir hydrolase; Bph rp; breast epithelial mucin associated antigen; valacyclovirase; biphenyl hydrolase-like protein; biphenyl hydrolase-related protein; breast epithelial mucin-associated antigen; BPH-RP; VACVASE; MGC41865; MGC125930; | 
| Gene ID | 670 | 
| mRNA Refseq | NM_004332 | 
| Protein Refseq | NP_004323 | 
| MIM | 603156 | 
| UniProt ID | Q86WA6 | 
| ◆ Recombinant Proteins | ||
| BPHL-1071M | Recombinant Mouse BPHL Protein, His (Fc)-Avi-tagged | +Inquiry | 
| BPHL-8604H | Recombinant Human BPHL, His tagged | +Inquiry | 
| BPHL-2460M | Recombinant Mouse BPHL Protein | +Inquiry | 
| BPHL-4597H | Recombinant Human BPHL protein, His&Myc-tagged | +Inquiry | 
| BPHL-3450H | Recombinant Human BPHL protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| BPHL-174HCL | Recombinant Human BPHL cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPHL Products
Required fields are marked with *
My Review for All BPHL Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            