Recombinant Human BPIFA1 protein, GST-tagged
| Cat.No. : | BPIFA1-1801H |
| Product Overview : | Recombinant Human BPIFA1 protein(1-256 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-256 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | BPIFA1 BPI fold containing family A, member 1 [ Homo sapiens ] |
| Official Symbol | BPIFA1 |
| Synonyms | BPIFA1; BPI fold containing family A, member 1; LUNX; NASG; PLUNC; SPURT; SPLUNC1; bA49G10.5; BPI fold-containing family A member 1; protein Plunc; von Ebner protein Hl; lung-specific protein X; ligand-binding protein RYA3; tracheal epithelium enriched protein; tracheal epithelium-enriched protein; nasopharyngeal carcinoma-related protein; palate, lung and nasal epithelium associated; secretory protein in upper respiratory tracts; palate lung and nasal epithelium clone protein; UNQ787/PRO1606 |
| Gene ID | 51297 |
| mRNA Refseq | NM_130852 |
| Protein Refseq | NP_057667 |
| MIM | 607412 |
| UniProt ID | Q9NP55 |
| ◆ Recombinant Proteins | ||
| BPIFA1-1801H | Recombinant Human BPIFA1 protein, GST-tagged | +Inquiry |
| BPIFA1-454H | Recombinant Human BPIFA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BPIFA1-2463H | Recombinant Human BPIFA1 protein, His-SUMO-tagged | +Inquiry |
| BPIFA1-664R | Recombinant Rat BPIFA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BPIFA1-2142H | Recombinant Human BPIFA1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPIFA1 Products
Required fields are marked with *
My Review for All BPIFA1 Products
Required fields are marked with *
