Recombinant Full Length Human BPY2C Protein, GST-tagged
| Cat.No. : | BPY2C-3774HF |
| Product Overview : | Human BPY2C full-length ORF ( AAI56665.1, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 106 amino acids |
| Description : | This gene is located in the nonrecombining portion of the Y chromosome, and expressed specifically in testis. The encoded protein interacts with ubiquitin protein ligase E3A and may be involved in male germ cell development and male infertility. Three nearly identical copies of this gene exist on chromosome Y; two copies are part of a palindromic region. This record represents the more telomeric copy within the palindrome. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 38.06 kDa |
| AA Sequence : | MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNTLLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BPY2C basic charge, Y-linked, 2C [ Homo sapiens ] |
| Official Symbol | BPY2C |
| Synonyms | BPY2C; basic charge, Y-linked, 2C; testis-specific basic protein Y 2; VCY2C; basic charge, Y-linked 2; variable charge, Y-linked, 2; variably charged protein Y 2; basic protein on Y chromosome 2; testis-specific basic protein on Y, 2; BPY2; VCY2; |
| Gene ID | 442868 |
| mRNA Refseq | NM_001002761 |
| Protein Refseq | NP_001002761 |
| UniProt ID | O14599 |
| ◆ Recombinant Proteins | ||
| BPY2C-3774HF | Recombinant Full Length Human BPY2C Protein, GST-tagged | +Inquiry |
| BPY2C-317H | Recombinant Human BPY2C Protein, GST-tagged | +Inquiry |
| BPY2C-2785H | Recombinant Human BPY2C Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPY2C Products
Required fields are marked with *
My Review for All BPY2C Products
Required fields are marked with *
