Recombinant Human BPY2C Protein, GST-tagged

Cat.No. : BPY2C-317H
Product Overview : Human BPY2C full-length ORF ( AAI56665.1, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is located in the nonrecombining portion of the Y chromosome, and expressed specifically in testis. The encoded protein interacts with ubiquitin protein ligase E3A and may be involved in male germ cell development and male infertility. Three nearly identical copies of this gene exist on chromosome Y; two copies are part of a palindromic region. This record represents the more telomeric copy within the palindrome.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 38.06 kDa
AA Sequence : MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNTLLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BPY2C basic charge, Y-linked, 2C [ Homo sapiens ]
Official Symbol BPY2C
Synonyms BPY2C; basic charge, Y-linked, 2C; testis-specific basic protein Y 2; VCY2C; basic charge, Y-linked 2; variable charge, Y-linked, 2; variably charged protein Y 2; basic protein on Y chromosome 2; testis-specific basic protein on Y, 2; BPY2; VCY2;
Gene ID 442868
mRNA Refseq NM_001002761
Protein Refseq NP_001002761
UniProt ID O14599

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BPY2C Products

Required fields are marked with *

My Review for All BPY2C Products

Required fields are marked with *

0
cart-icon
0
compare icon