Recombinant Full Length Human BRF1 Protein, GST-tagged

Cat.No. : BRF1-3794HF
Product Overview : Human BRF1 full-length ORF ( AAH16743, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 208 amino acids
Description : This gene encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Two alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. Other transcript variants are possible, but their full-length natures have not been completely characterized.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 48.62 kDa
AA Sequence : MTGRVCRGCGGTDIELDAARGDTVCTACGSVLEDNIIMSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYPVCRTEGTPHMLLDLSDLLQVDSLRPASFPTWGCDLGVVTRVVTGVYPRCLHASQWPVCAACPVRKFWSVG
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BRF1 BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae) [ Homo sapiens ]
Official Symbol BRF1
Synonyms BRF1; BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae); GTF3B, TAF3B2, TAF3C, TATA box binding protein (TBP) associated factor, RNA polymerase III, GTF3B subunit 2; transcription factor IIIB 90 kDa subunit; BRF; hBRF; TFIIIB90; B - related factor 1; general transcription factor IIIB, 90kD subunit; TBP - associated factor, RNA polymerase III, 90kD; TATA box binding protein (TBP)-associated factor 3C; TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3B subunit 2; BRF-1; GTF3B; TAF3C; TAF3B2; TF3B90; TAFIII90; FLJ42674; FLJ43034; MGC105048;
Gene ID 2972
mRNA Refseq NM_001242786
Protein Refseq NP_001229715
MIM 604902
UniProt ID Q92994

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRF1 Products

Required fields are marked with *

My Review for All BRF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon