Recombinant Human BRF1 Protein, GST-tagged
Cat.No. : | BRF1-336H |
Product Overview : | Human BRF1 full-length ORF ( AAH16743, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Two alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. Other transcript variants are possible, but their full-length natures have not been completely characterized. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 48.62 kDa |
AA Sequence : | MTGRVCRGCGGTDIELDAARGDTVCTACGSVLEDNIIMSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYPVCRTEGTPHMLLDLSDLLQVDSLRPASFPTWGCDLGVVTRVVTGVYPRCLHASQWPVCAACPVRKFWSVG |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BRF1 BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | BRF1 |
Synonyms | BRF1; BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae); GTF3B, TAF3B2, TAF3C, TATA box binding protein (TBP) associated factor, RNA polymerase III, GTF3B subunit 2; transcription factor IIIB 90 kDa subunit; BRF; hBRF; TFIIIB90; B - related factor 1; general transcription factor IIIB, 90kD subunit; TBP - associated factor, RNA polymerase III, 90kD; TATA box binding protein (TBP)-associated factor 3C; TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3B subunit 2; BRF-1; GTF3B; TAF3C; TAF3B2; TF3B90; TAFIII90; FLJ42674; FLJ43034; MGC105048; |
Gene ID | 2972 |
mRNA Refseq | NM_001242786 |
Protein Refseq | NP_001229715 |
MIM | 604902 |
UniProt ID | Q92994 |
◆ Recombinant Proteins | ||
BRF1-5844H | Recombinant Human BRF1 protein, His-tagged | +Inquiry |
BRF1-336H | Recombinant Human BRF1 Protein, GST-tagged | +Inquiry |
Brf1-1892M | Recombinant Mouse Brf1 Protein, Myc/DDK-tagged | +Inquiry |
BRF1-3794HF | Recombinant Full Length Human BRF1 Protein, GST-tagged | +Inquiry |
BRF1-2791H | Recombinant Human BRF1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRF1-180HCL | Recombinant Human BRF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRF1 Products
Required fields are marked with *
My Review for All BRF1 Products
Required fields are marked with *