Recombinant Full Length Human BYSL Protein, C-Flag-tagged
Cat.No. : | BYSL-211HFL |
Product Overview : | Recombinant Full Length Human BYSL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Bystin is expressed as a 2-kb major transcript and a 3.6-kb minor transcript in SNG-M cells and in human trophoblastic teratocarcinoma HT-H cells. Protein binding assays determined that bystin binds directly to trophinin and tastin, and that binding is enhanced when cytokeratins 8 and 18 are present. Immunocytochemistry of HT-H cells showed that bystin colocalizes with trophinin, tastin, and the cytokeratins, suggesting that these molecules form a complex in trophectoderm cells at the time of implantation. Using immunohistochemistry it was determined that trophinin and bystin are found in the placenta from the sixth week of pregnancy. Both proteins were localized in the cytoplasm of the syncytiotrophoblast in the chorionic villi and in endometrial decidual cells at the uteroplacental interface. After week 10, the levels of trophinin, tastin, and bystin decreased and then disappeared from placental villi. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.4 kDa |
AA Sequence : | MPKFKAARGVGGQEKHAPLADQILAGNAVRAGVREKRRGRGTGEAEEEYVGPRLSRRILQQARQQQEELE AEHGTGDKPAAPRERTTRLGPRMPQDGSDDEDEEWPTLEKAATMTAAGHHAEVVVDPEDERAIEMFMNKN PPARRTLADIIMEKLTEKQTEVETVMSEVSGFPMPQLDPRVLEVYRGVREVLSKYRSGKLPKAFKIIPAL SNWEQILYVTEPEAWTAAAMYQATRIFASNLKERMAQRFYNLVLLPRVRDDVAEYKRLNFHLYMALKKAL FKPGAWFKGILIPLCESGTCTLREAIIVGSIITKCSIPVLHSSAAMLKIAEMEYSGANSIFLRLLLDKKY ALPYRVLDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRE LQSAVPRDVEDVPITVETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Stem cell - Pluripotency |
Full Length : | Full L. |
Gene Name | BYSL bystin like [ Homo sapiens (human) ] |
Official Symbol | BYSL |
Synonyms | Enp1; BYSTIN |
Gene ID | 705 |
mRNA Refseq | NM_004053.4 |
Protein Refseq | NP_004044.3 |
MIM | 603871 |
UniProt ID | Q13895 |
◆ Recombinant Proteins | ||
Bysl-1123M | Recombinant Mouse Bysl Protein, His (Fc)-Avi-tagged | +Inquiry |
Bysl-1904M | Recombinant Mouse Bysl Protein, Myc/DDK-tagged | +Inquiry |
Bysl-2552M | Recombinant Mouse Bysl Protein | +Inquiry |
BYSL-211HFL | Recombinant Full Length Human BYSL Protein, C-Flag-tagged | +Inquiry |
BYSL-463H | Recombinant Human BYSL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BYSL-8379HCL | Recombinant Human BYSL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BYSL Products
Required fields are marked with *
My Review for All BYSL Products
Required fields are marked with *
0
Inquiry Basket