Recombinant Full Length Human BZW1 Protein, GST-tagged

Cat.No. : BZW1-1698HF
Product Overview : Human BZW1 full-length ORF ( NP_055485.2, 1 a.a. - 353 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 353 amino acids
Description : Enables RNA binding activity and cadherin binding activity. Located in cytoplasm.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 66.9 kDa
AA Sequence : MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGFSESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKEEMKKNNIHFMKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAEEGD
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BZW1 basic leucine zipper and W2 domains 1 [ Homo sapiens ]
Official Symbol BZW1
Synonyms BZW1; basic leucine zipper and W2 domains 1; basic leucine zipper and W2 domain-containing protein 1; BZAP45; KIAA0005; basic leucine-zipper protein BZAP45; putative protein product of Nbla10236; Nbla10236
Gene ID 9689
mRNA Refseq NM_001207067
Protein Refseq NP_001193996
MIM 619252
UniProt ID Q7L1Q6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BZW1 Products

Required fields are marked with *

My Review for All BZW1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon