Recombinant Full Length Human BZW1 Protein, GST-tagged
| Cat.No. : | BZW1-1698HF |
| Product Overview : | Human BZW1 full-length ORF ( NP_055485.2, 1 a.a. - 353 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 353 amino acids |
| Description : | Enables RNA binding activity and cadherin binding activity. Located in cytoplasm. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 66.9 kDa |
| AA Sequence : | MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGFSESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKEEMKKNNIHFMKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAEEGD |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BZW1 basic leucine zipper and W2 domains 1 [ Homo sapiens ] |
| Official Symbol | BZW1 |
| Synonyms | BZW1; basic leucine zipper and W2 domains 1; basic leucine zipper and W2 domain-containing protein 1; BZAP45; KIAA0005; basic leucine-zipper protein BZAP45; putative protein product of Nbla10236; Nbla10236 |
| Gene ID | 9689 |
| mRNA Refseq | NM_001207067 |
| Protein Refseq | NP_001193996 |
| MIM | 619252 |
| UniProt ID | Q7L1Q6 |
| ◆ Recombinant Proteins | ||
| BZW1-410H | Recombinant Human BZW1 Protein, GST-tagged | +Inquiry |
| BZW1-1698HF | Recombinant Full Length Human BZW1 Protein, GST-tagged | +Inquiry |
| BZW1-1036R | Recombinant Rat BZW1 Protein | +Inquiry |
| BZW1-694R | Recombinant Rat BZW1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BZW1-10344H | Recombinant Human BZW1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BZW1 Products
Required fields are marked with *
My Review for All BZW1 Products
Required fields are marked with *



