Recombinant Human BZW1 Protein, GST-tagged
Cat.No. : | BZW1-410H |
Product Overview : | Human BZW1 full-length ORF ( NP_055485.2, 1 a.a. - 353 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 66.9 kDa |
AA Sequence : | MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGFSESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKEEMKKNNIHFMKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAEEGD |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BZW1 basic leucine zipper and W2 domains 1 [ Homo sapiens ] |
Official Symbol | BZW1 |
Synonyms | BZW1; basic leucine zipper and W2 domains 1; basic leucine zipper and W2 domain-containing protein 1; BZAP45; KIAA0005; basic leucine-zipper protein BZAP45; putative protein product of Nbla10236; Nbla10236; |
Gene ID | 9689 |
mRNA Refseq | NM_001207067 |
Protein Refseq | NP_001193996 |
UniProt ID | Q7L1Q6 |
◆ Recombinant Proteins | ||
BZW1-10344H | Recombinant Human BZW1, GST-tagged | +Inquiry |
BZW1-410H | Recombinant Human BZW1 Protein, GST-tagged | +Inquiry |
BZW1-1125M | Recombinant Mouse BZW1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BZW1-1654C | Recombinant Chicken BZW1 | +Inquiry |
BZW1-1698HF | Recombinant Full Length Human BZW1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BZW1 Products
Required fields are marked with *
My Review for All BZW1 Products
Required fields are marked with *
0
Inquiry Basket