Recombinant Full Length Human C10orf53 Protein, GST-tagged

• Cat.No.: C10orf53-1702HF
• Product Overview: Human C10orf53 full-length ORF ( AAH28127.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 157 amino acids
• Description: C10orf53 (Chromosome 10 Open Reading Frame 53) is a Protein Coding gene.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 44 kDa
• AA Sequence: MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDLEFGKLTPSSDKRTTSSSRLTFHQLSSPCGMKVSPLQQFPQKTQDLTCIVLAQIGSCIHFQTNLCDLGWPGLDHMLISGLEKRGTQPY
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C10orf53 chromosome 10 open reading frame 53 [ Homo sapiens ]
• Official Symbol: C10orf53
• Synonyms: C10orf53
• Gene ID: 282966
• mRNA Refseq: NM_182554.2
• Protein Refseq: NP_872360.2
• UniProt ID: Q8N6V4