Recombinant Full Length Human C10orf53 Protein, GST-tagged

Cat.No. : C10orf53-1702HF
Product Overview : Human C10orf53 full-length ORF ( AAH28127.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 157 amino acids
Description : C10orf53 (Chromosome 10 Open Reading Frame 53) is a Protein Coding gene.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 44 kDa
AA Sequence : MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDLEFGKLTPSSDKRTTSSSRLTFHQLSSPCGMKVSPLQQFPQKTQDLTCIVLAQIGSCIHFQTNLCDLGWPGLDHMLISGLEKRGTQPY
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C10orf53 chromosome 10 open reading frame 53 [ Homo sapiens ]
Official Symbol C10orf53
Synonyms C10orf53
Gene ID 282966
mRNA Refseq NM_182554.2
Protein Refseq NP_872360.2
UniProt ID Q8N6V4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C10orf53 Products

Required fields are marked with *

My Review for All C10orf53 Products

Required fields are marked with *

0
cart-icon
0
compare icon