Recombinant Human C10orf53 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C10orf53-877H |
Product Overview : | C10orf53 MS Standard C13 and N15-labeled recombinant protein (NP_001035892) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C10orf53 (Chromosome 10 Open Reading Frame 53) is a Protein Coding gene. Diseases associated with C10orf53 include Uterine Corpus Endometrial Carcinoma. |
Molecular Mass : | 10.2 kDa |
AA Sequence : | MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDLEFGGDGKLDPLCEKARIAVLNAYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C10orf53 chromosome 10 open reading frame 53 [ Homo sapiens (human) ] |
Official Symbol | C10orf53 |
Synonyms | C10orf53; chromosome 10 open reading frame 53; FLJ60598; UPF0728 protein C10orf53 |
Gene ID | 282966 |
mRNA Refseq | NM_001042427 |
Protein Refseq | NP_001035892 |
UniProt ID | Q8N6V4 |
◆ Recombinant Proteins | ||
C10orf53-435H | Recombinant Human C10orf53 Protein, GST-tagged | +Inquiry |
C10orf53-1287H | Recombinant Human C10orf53 Protein, MYC/DDK-tagged | +Inquiry |
C10orf53-10352H | Recombinant Human C10orf53, His-tagged | +Inquiry |
C10orf53-1702HF | Recombinant Full Length Human C10orf53 Protein, GST-tagged | +Inquiry |
C10orf53-877H | Recombinant Human C10orf53 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
C10orf53-70HCL | Recombinant Human C10orf53 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C10orf53 Products
Required fields are marked with *
My Review for All C10orf53 Products
Required fields are marked with *