Recombinant Full Length Human C11orf1 Protein, GST-tagged

• Cat.No.: C11orf1-1794HF
• Product Overview: Human C11orf1 full-length ORF ( NP_073598.1, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 150 amino acids
• Description: Located in nucleoplasm.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 44.2 kDa
• AA Sequence: MAASQCLCCSKFLFQRQNLACFLTNPHCGSLVNADGHGEVWTDWNNMSKFFQYGWRCTTNENTYSNRTLMGNWNQERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHWFPGHQPELDPPRYKCTEKSTYMNSYSKP
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C11orf1 chromosome 11 open reading frame 1 [ Homo sapiens ]
• Official Symbol: C11orf1
• Synonyms: Chromosome 11 Open Reading Frame 1; UPF0686 Protein C11orf1; FLJ23499
• Gene ID: 64776
• mRNA Refseq: NM_022761.2
• Protein Refseq: NP_073598.1
• UniProt ID: Q9H5F2