Recombinant Human C11orf1 Protein, GST-tagged
Cat.No. : | C11orf1-456H |
Product Overview : | Human C11orf1 full-length ORF ( NP_073598.1, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 44.2 kDa |
AA Sequence : | MAASQCLCCSKFLFQRQNLACFLTNPHCGSLVNADGHGEVWTDWNNMSKFFQYGWRCTTNENTYSNRTLMGNWNQERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHWFPGHQPELDPPRYKCTEKSTYMNSYSKP |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C11orf1 chromosome 11 open reading frame 1 [ Homo sapiens ] |
Official Symbol | C11orf1 |
Synonyms | C11orf1 |
Gene ID | 64776 |
mRNA Refseq | NM_022761.2 |
Protein Refseq | NP_073598.1 |
UniProt ID | Q9H5F2 |
◆ Recombinant Proteins | ||
C11orf1-456H | Recombinant Human C11orf1 Protein, GST-tagged | +Inquiry |
C11orf1-1286H | Recombinant Human C11orf1 Protein, His-tagged | +Inquiry |
C11orf1-1794HF | Recombinant Full Length Human C11orf1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf1-8356HCL | Recombinant Human C11orf1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C11orf1 Products
Required fields are marked with *
My Review for All C11orf1 Products
Required fields are marked with *