Recombinant Human C11orf1 Protein, GST-tagged

Cat.No. : C11orf1-456H
Product Overview : Human C11orf1 full-length ORF ( NP_073598.1, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 44.2 kDa
AA Sequence : MAASQCLCCSKFLFQRQNLACFLTNPHCGSLVNADGHGEVWTDWNNMSKFFQYGWRCTTNENTYSNRTLMGNWNQERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHWFPGHQPELDPPRYKCTEKSTYMNSYSKP
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C11orf1 chromosome 11 open reading frame 1 [ Homo sapiens ]
Official Symbol C11orf1
Synonyms C11orf1
Gene ID 64776
mRNA Refseq NM_022761.2
Protein Refseq NP_073598.1
UniProt ID Q9H5F2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C11orf1 Products

Required fields are marked with *

My Review for All C11orf1 Products

Required fields are marked with *

0
cart-icon