Recombinant Full Length Human C11orf46 Protein, GST-tagged

• Cat.No.: C11orf46-1821HF
• Product Overview: Human C11orf46 full-length ORF ( NP_689529.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 260 amino acids
• Description: The protein encoded by this gene is an effector protein. It interacts with ADP-ribosylation factor-like 14 [ARL14, also known as ADP-ribosylation factor 7 (ARF7)], beta-actin (ACTB) and actin-based motor protein myosin 1E (MYO1E). ARL14 is a small GTPase; it controls the export of major histocompatibility class II molecules by connecting to the actin network via this effector protein.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 55.7 kDa
• AA Sequence: MMDPCSVGVQLRTTNECHKTYYTRHTGFKTLQELSSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKFGRQLVPGWKLCPKCTQIINGSVDVDTEDRQKRKPESDGRTAKALRSLQFTNPGRQTEFAPETGKREKRRLTKNATAGSDRQVIPAKSKVYDSQGLLIFSGMDLCDCLDEDCLGCFYACPACGSTKCGAECRCDRKWLYEQIEIEGGEIIHNKHAG
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C11orf46 chromosome 11 open reading frame 46 [ Homo sapiens ]
• Official Symbol: C11orf46
• Synonyms: C11ORF46; chromosome 11 open reading frame 46; ARF7 effector protein; FLJ38968; uncharacterized protein C11orf46; ARF7EP; dJ299F11.1
• Gene ID: 120534
• mRNA Refseq: NM_152316
• Protein Refseq: NP_689529
• MIM: 612295
• UniProt ID: Q8N8R7